PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008241869.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 233aa    MW: 25969.9 Da    PI: 4.9523
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008241869.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.41.5e-35131121100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCa+Ck++rrkC + C +apyfpa++ ++f+ ++k+FG+sn++k+++ + +++r++a++s++ e++ar +dPv+G++g+i+ l+ q++ l++el+
  XP_008241869.1  13 ACASCKHQRRKCDETCEMAPYFPASRYSEFQHAQKIFGVSNIQKIMAMAAPDQRQAAAESILTEGNARKNDPVHGCLGIIRGLNAQIQGLETELH 107
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      +k++
  XP_008241869.1 108 IMKQH 112
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.240.103.7E-4927IPR001138Zn(2)-C6 fungal-type DNA-binding domain
PROSITE profilePS5089123.58412113IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-3313110IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MENRDQVAAQ NHACASCKHQ RRKCDETCEM APYFPASRYS EFQHAQKIFG VSNIQKIMAM  60
AAPDQRQAAA ESILTEGNAR KNDPVHGCLG IIRGLNAQIQ GLETELHIMK QHLELCKEKE  120
ELDGKKNQAK EDLQHDQSDG LNFPSPIVPD LPSHVMAEMR KYEQGYNYWS TLEDAEEEVF  180
DIQLIEPVLF ESKLKGNASS SGSGKSSCSA AASKAQEKQP SESLQEKTTE DEA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241869.11e-175PREDICTED: LOB domain-containing protein 22-like
TrEMBLM5VSQ01e-105M5VSQ0_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.15e-28LOB domain-containing protein 22